iotbx.tst_bioinformatics
index
/net/chevy/raid1/nat/src/cctbx_project/iotbx/tst_bioinformatics.pyc

 
Modules
       
iotbx.bioinformatics
sys
unittest

 
Classes
       
unittest.case.TestCase(__builtin__.object)
test_alignment
test_alignment_parse
test_clustal_alignment
test_fasta_alignment
test_fasta_sequence
test_hhalign_parser
test_hhsearch_parser
test_midline
test_pir_alignment
test_pir_sequence
test_sequence
test_sequence_parse

 
class test_alignment(unittest.case.TestCase)
    
Method resolution order:
test_alignment
unittest.case.TestCase
__builtin__.object

Methods defined here:
setUp(self)
test__str__(self)
test_copy(self)
test_error(self)
test_extend(self)
test_identity_count(self)
test_identity_fraction(self)
test_length(self)
test_multiplicity(self)

Methods inherited from unittest.case.TestCase:
__call__(self, *args, **kwds)
__eq__(self, other)
__hash__(self)
__init__(self, methodName='runTest')
Create an instance of the class that will use the named test
method when executed. Raises a ValueError if the instance does
not have a method with the specified name.
__ne__(self, other)
__repr__(self)
__str__(self)
addCleanup(self, function, *args, **kwargs)
Add a function, with arguments, to be called when the test is
completed. Functions added are called on a LIFO basis and are
called after tearDown on test failure or success.
 
Cleanup items are called even if setUp fails (unlike tearDown).
addTypeEqualityFunc(self, typeobj, function)
Add a type specific assertEqual style function to compare a type.
 
This method is for use by TestCase subclasses that need to register
their own type equality functions to provide nicer error messages.
 
Args:
    typeobj: The data type to call this function on when both values
            are of the same type in assertEqual().
    function: The callable taking two arguments and an optional
            msg= argument that raises self.failureException with a
            useful error message when the two arguments are not equal.
assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertAlmostEquals = assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertDictContainsSubset(self, expected, actual, msg=None)
Checks whether actual is a superset of expected.
assertDictEqual(self, d1, d2, msg=None)
assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertEquals = assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertFalse(self, expr, msg=None)
Check that the expression is false.
assertGreater(self, a, b, msg=None)
Just like assertTrue(a > b), but with a nicer default message.
assertGreaterEqual(self, a, b, msg=None)
Just like assertTrue(a >= b), but with a nicer default message.
assertIn(self, member, container, msg=None)
Just like assertTrue(a in b), but with a nicer default message.
assertIs(self, expr1, expr2, msg=None)
Just like assertTrue(a is b), but with a nicer default message.
assertIsInstance(self, obj, cls, msg=None)
Same as assertTrue(isinstance(obj, cls)), with a nicer
default message.
assertIsNone(self, obj, msg=None)
Same as assertTrue(obj is None), with a nicer default message.
assertIsNot(self, expr1, expr2, msg=None)
Just like assertTrue(a is not b), but with a nicer default message.
assertIsNotNone(self, obj, msg=None)
Included for symmetry with assertIsNone.
assertItemsEqual(self, expected_seq, actual_seq, msg=None)
An unordered sequence specific comparison. It asserts that
actual_seq and expected_seq have the same element counts.
Equivalent to::
 
    assertEqual(Counter(iter(actual_seq)),
                     Counter(iter(expected_seq)))
 
Asserts that each element has the same count in both sequences.
Example:
    - [0, 1, 1] and [1, 0, 1] compare equal.
    - [0, 0, 1] and [0, 1] compare unequal.
assertLess(self, a, b, msg=None)
Just like assertTrue(a < b), but with a nicer default message.
assertLessEqual(self, a, b, msg=None)
Just like assertTrue(a <= b), but with a nicer default message.
assertListEqual(self, list1, list2, msg=None)
A list-specific equality assertion.
 
Args:
    list1: The first list to compare.
    list2: The second list to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assertMultiLineEqual(self, first, second, msg=None)
Assert that two multi-line strings are equal.
assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotAlmostEquals = assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotEquals = assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotIn(self, member, container, msg=None)
Just like assertTrue(a not in b), but with a nicer default message.
assertNotIsInstance(self, obj, cls, msg=None)
Included for symmetry with assertIsInstance.
assertNotRegexpMatches(self, text, unexpected_regexp, msg=None)
Fail the test if the text matches the regular expression.
assertRaises(self, excClass, callableObj=None, *args, **kwargs)
Fail unless an exception of class excClass is thrown
by callableObj when invoked with arguments args and keyword
arguments kwargs. If a different type of exception is
thrown, it will not be caught, and the test case will be
deemed to have suffered an error, exactly as for an
unexpected exception.
 
If called with callableObj omitted or None, will return a
context object used like this::
 
     with assertRaises(SomeException):
         do_something()
 
The context manager keeps a reference to the exception as
the 'exception' attribute. This allows you to inspect the
exception after the assertion::
 
    with assertRaises(SomeException) as cm:
        do_something()
    the_exception = cm.exception
    assertEqual(the_exception.error_code, 3)
assertRaisesRegexp(self, expected_exception, expected_regexp, callable_obj=None, *args, **kwargs)
Asserts that the message in a raised exception matches a regexp.
 
Args:
    expected_exception: Exception class expected to be raised.
    expected_regexp: Regexp (re pattern object or string) expected
            to be found in error message.
    callable_obj: Function to be called.
    args: Extra args.
    kwargs: Extra kwargs.
assertRegexpMatches(self, text, expected_regexp, msg=None)
Fail the test unless the text matches the regular expression.
assertSequenceEqual(self, seq1, seq2, msg=None, seq_type=None)
An equality assertion for ordered sequences (like lists and tuples).
 
For the purposes of this function, a valid ordered sequence type is one
which can be indexed, has a length, and has an equality operator.
 
Args:
    seq1: The first sequence to compare.
    seq2: The second sequence to compare.
    seq_type: The expected datatype of the sequences, or None if no
            datatype should be enforced.
    msg: Optional message to use on failure instead of a list of
            differences.
assertSetEqual(self, set1, set2, msg=None)
A set-specific equality assertion.
 
Args:
    set1: The first set to compare.
    set2: The second set to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
 
assertSetEqual uses ducktyping to support different types of sets, and
is optimized for sets specifically (parameters must support a
difference method).
assertTrue(self, expr, msg=None)
Check that the expression is true.
assertTupleEqual(self, tuple1, tuple2, msg=None)
A tuple-specific equality assertion.
 
Args:
    tuple1: The first tuple to compare.
    tuple2: The second tuple to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assert_ = assertTrue(self, expr, msg=None)
Check that the expression is true.
countTestCases(self)
debug(self)
Run the test without collecting errors in a TestResult
defaultTestResult(self)
doCleanups(self)
Execute all cleanup functions. Normally called for you after
tearDown.
fail(self, msg=None)
Fail immediately, with the given message.
failIf = deprecated_func(*args, **kwargs)
failIfAlmostEqual = deprecated_func(*args, **kwargs)
failIfEqual = deprecated_func(*args, **kwargs)
failUnless = deprecated_func(*args, **kwargs)
failUnlessAlmostEqual = deprecated_func(*args, **kwargs)
failUnlessEqual = deprecated_func(*args, **kwargs)
failUnlessRaises = deprecated_func(*args, **kwargs)
id(self)
run(self, result=None)
shortDescription(self)
Returns a one-line description of the test, or None if no
description has been provided.
 
The default implementation of this method returns the first line of
the specified test method's docstring.
skipTest(self, reason)
Skip this test.
tearDown(self)
Hook method for deconstructing the test fixture after testing it.

Class methods inherited from unittest.case.TestCase:
setUpClass(cls) from __builtin__.type
Hook method for setting up class fixture before running tests in the class.
tearDownClass(cls) from __builtin__.type
Hook method for deconstructing the class fixture after running all tests in the class.

Data descriptors inherited from unittest.case.TestCase:
__dict__
dictionary for instance variables (if defined)
__weakref__
list of weak references to the object (if defined)

Data and other attributes inherited from unittest.case.TestCase:
failureException = <type 'exceptions.AssertionError'>
Assertion failed.
longMessage = False
maxDiff = 640

 
class test_alignment_parse(unittest.case.TestCase)
    
Method resolution order:
test_alignment_parse
unittest.case.TestCase
__builtin__.object

Methods defined here:
testAli(self)
testClustal(self)
testFasta(self)
testPir(self)
test_filename_selection(self)
test_known_formats(self)

Methods inherited from unittest.case.TestCase:
__call__(self, *args, **kwds)
__eq__(self, other)
__hash__(self)
__init__(self, methodName='runTest')
Create an instance of the class that will use the named test
method when executed. Raises a ValueError if the instance does
not have a method with the specified name.
__ne__(self, other)
__repr__(self)
__str__(self)
addCleanup(self, function, *args, **kwargs)
Add a function, with arguments, to be called when the test is
completed. Functions added are called on a LIFO basis and are
called after tearDown on test failure or success.
 
Cleanup items are called even if setUp fails (unlike tearDown).
addTypeEqualityFunc(self, typeobj, function)
Add a type specific assertEqual style function to compare a type.
 
This method is for use by TestCase subclasses that need to register
their own type equality functions to provide nicer error messages.
 
Args:
    typeobj: The data type to call this function on when both values
            are of the same type in assertEqual().
    function: The callable taking two arguments and an optional
            msg= argument that raises self.failureException with a
            useful error message when the two arguments are not equal.
assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertAlmostEquals = assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertDictContainsSubset(self, expected, actual, msg=None)
Checks whether actual is a superset of expected.
assertDictEqual(self, d1, d2, msg=None)
assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertEquals = assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertFalse(self, expr, msg=None)
Check that the expression is false.
assertGreater(self, a, b, msg=None)
Just like assertTrue(a > b), but with a nicer default message.
assertGreaterEqual(self, a, b, msg=None)
Just like assertTrue(a >= b), but with a nicer default message.
assertIn(self, member, container, msg=None)
Just like assertTrue(a in b), but with a nicer default message.
assertIs(self, expr1, expr2, msg=None)
Just like assertTrue(a is b), but with a nicer default message.
assertIsInstance(self, obj, cls, msg=None)
Same as assertTrue(isinstance(obj, cls)), with a nicer
default message.
assertIsNone(self, obj, msg=None)
Same as assertTrue(obj is None), with a nicer default message.
assertIsNot(self, expr1, expr2, msg=None)
Just like assertTrue(a is not b), but with a nicer default message.
assertIsNotNone(self, obj, msg=None)
Included for symmetry with assertIsNone.
assertItemsEqual(self, expected_seq, actual_seq, msg=None)
An unordered sequence specific comparison. It asserts that
actual_seq and expected_seq have the same element counts.
Equivalent to::
 
    assertEqual(Counter(iter(actual_seq)),
                     Counter(iter(expected_seq)))
 
Asserts that each element has the same count in both sequences.
Example:
    - [0, 1, 1] and [1, 0, 1] compare equal.
    - [0, 0, 1] and [0, 1] compare unequal.
assertLess(self, a, b, msg=None)
Just like assertTrue(a < b), but with a nicer default message.
assertLessEqual(self, a, b, msg=None)
Just like assertTrue(a <= b), but with a nicer default message.
assertListEqual(self, list1, list2, msg=None)
A list-specific equality assertion.
 
Args:
    list1: The first list to compare.
    list2: The second list to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assertMultiLineEqual(self, first, second, msg=None)
Assert that two multi-line strings are equal.
assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotAlmostEquals = assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotEquals = assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotIn(self, member, container, msg=None)
Just like assertTrue(a not in b), but with a nicer default message.
assertNotIsInstance(self, obj, cls, msg=None)
Included for symmetry with assertIsInstance.
assertNotRegexpMatches(self, text, unexpected_regexp, msg=None)
Fail the test if the text matches the regular expression.
assertRaises(self, excClass, callableObj=None, *args, **kwargs)
Fail unless an exception of class excClass is thrown
by callableObj when invoked with arguments args and keyword
arguments kwargs. If a different type of exception is
thrown, it will not be caught, and the test case will be
deemed to have suffered an error, exactly as for an
unexpected exception.
 
If called with callableObj omitted or None, will return a
context object used like this::
 
     with assertRaises(SomeException):
         do_something()
 
The context manager keeps a reference to the exception as
the 'exception' attribute. This allows you to inspect the
exception after the assertion::
 
    with assertRaises(SomeException) as cm:
        do_something()
    the_exception = cm.exception
    assertEqual(the_exception.error_code, 3)
assertRaisesRegexp(self, expected_exception, expected_regexp, callable_obj=None, *args, **kwargs)
Asserts that the message in a raised exception matches a regexp.
 
Args:
    expected_exception: Exception class expected to be raised.
    expected_regexp: Regexp (re pattern object or string) expected
            to be found in error message.
    callable_obj: Function to be called.
    args: Extra args.
    kwargs: Extra kwargs.
assertRegexpMatches(self, text, expected_regexp, msg=None)
Fail the test unless the text matches the regular expression.
assertSequenceEqual(self, seq1, seq2, msg=None, seq_type=None)
An equality assertion for ordered sequences (like lists and tuples).
 
For the purposes of this function, a valid ordered sequence type is one
which can be indexed, has a length, and has an equality operator.
 
Args:
    seq1: The first sequence to compare.
    seq2: The second sequence to compare.
    seq_type: The expected datatype of the sequences, or None if no
            datatype should be enforced.
    msg: Optional message to use on failure instead of a list of
            differences.
assertSetEqual(self, set1, set2, msg=None)
A set-specific equality assertion.
 
Args:
    set1: The first set to compare.
    set2: The second set to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
 
assertSetEqual uses ducktyping to support different types of sets, and
is optimized for sets specifically (parameters must support a
difference method).
assertTrue(self, expr, msg=None)
Check that the expression is true.
assertTupleEqual(self, tuple1, tuple2, msg=None)
A tuple-specific equality assertion.
 
Args:
    tuple1: The first tuple to compare.
    tuple2: The second tuple to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assert_ = assertTrue(self, expr, msg=None)
Check that the expression is true.
countTestCases(self)
debug(self)
Run the test without collecting errors in a TestResult
defaultTestResult(self)
doCleanups(self)
Execute all cleanup functions. Normally called for you after
tearDown.
fail(self, msg=None)
Fail immediately, with the given message.
failIf = deprecated_func(*args, **kwargs)
failIfAlmostEqual = deprecated_func(*args, **kwargs)
failIfEqual = deprecated_func(*args, **kwargs)
failUnless = deprecated_func(*args, **kwargs)
failUnlessAlmostEqual = deprecated_func(*args, **kwargs)
failUnlessEqual = deprecated_func(*args, **kwargs)
failUnlessRaises = deprecated_func(*args, **kwargs)
id(self)
run(self, result=None)
setUp(self)
Hook method for setting up the test fixture before exercising it.
shortDescription(self)
Returns a one-line description of the test, or None if no
description has been provided.
 
The default implementation of this method returns the first line of
the specified test method's docstring.
skipTest(self, reason)
Skip this test.
tearDown(self)
Hook method for deconstructing the test fixture after testing it.

Class methods inherited from unittest.case.TestCase:
setUpClass(cls) from __builtin__.type
Hook method for setting up class fixture before running tests in the class.
tearDownClass(cls) from __builtin__.type
Hook method for deconstructing the class fixture after running all tests in the class.

Data descriptors inherited from unittest.case.TestCase:
__dict__
dictionary for instance variables (if defined)
__weakref__
list of weak references to the object (if defined)

Data and other attributes inherited from unittest.case.TestCase:
failureException = <type 'exceptions.AssertionError'>
Assertion failed.
longMessage = False
maxDiff = 640

 
class test_clustal_alignment(unittest.case.TestCase)
    
Method resolution order:
test_clustal_alignment
unittest.case.TestCase
__builtin__.object

Methods defined here:
setUp(self)
test__str__(self)
test_copy(self)
test_format(self)

Methods inherited from unittest.case.TestCase:
__call__(self, *args, **kwds)
__eq__(self, other)
__hash__(self)
__init__(self, methodName='runTest')
Create an instance of the class that will use the named test
method when executed. Raises a ValueError if the instance does
not have a method with the specified name.
__ne__(self, other)
__repr__(self)
__str__(self)
addCleanup(self, function, *args, **kwargs)
Add a function, with arguments, to be called when the test is
completed. Functions added are called on a LIFO basis and are
called after tearDown on test failure or success.
 
Cleanup items are called even if setUp fails (unlike tearDown).
addTypeEqualityFunc(self, typeobj, function)
Add a type specific assertEqual style function to compare a type.
 
This method is for use by TestCase subclasses that need to register
their own type equality functions to provide nicer error messages.
 
Args:
    typeobj: The data type to call this function on when both values
            are of the same type in assertEqual().
    function: The callable taking two arguments and an optional
            msg= argument that raises self.failureException with a
            useful error message when the two arguments are not equal.
assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertAlmostEquals = assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertDictContainsSubset(self, expected, actual, msg=None)
Checks whether actual is a superset of expected.
assertDictEqual(self, d1, d2, msg=None)
assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertEquals = assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertFalse(self, expr, msg=None)
Check that the expression is false.
assertGreater(self, a, b, msg=None)
Just like assertTrue(a > b), but with a nicer default message.
assertGreaterEqual(self, a, b, msg=None)
Just like assertTrue(a >= b), but with a nicer default message.
assertIn(self, member, container, msg=None)
Just like assertTrue(a in b), but with a nicer default message.
assertIs(self, expr1, expr2, msg=None)
Just like assertTrue(a is b), but with a nicer default message.
assertIsInstance(self, obj, cls, msg=None)
Same as assertTrue(isinstance(obj, cls)), with a nicer
default message.
assertIsNone(self, obj, msg=None)
Same as assertTrue(obj is None), with a nicer default message.
assertIsNot(self, expr1, expr2, msg=None)
Just like assertTrue(a is not b), but with a nicer default message.
assertIsNotNone(self, obj, msg=None)
Included for symmetry with assertIsNone.
assertItemsEqual(self, expected_seq, actual_seq, msg=None)
An unordered sequence specific comparison. It asserts that
actual_seq and expected_seq have the same element counts.
Equivalent to::
 
    assertEqual(Counter(iter(actual_seq)),
                     Counter(iter(expected_seq)))
 
Asserts that each element has the same count in both sequences.
Example:
    - [0, 1, 1] and [1, 0, 1] compare equal.
    - [0, 0, 1] and [0, 1] compare unequal.
assertLess(self, a, b, msg=None)
Just like assertTrue(a < b), but with a nicer default message.
assertLessEqual(self, a, b, msg=None)
Just like assertTrue(a <= b), but with a nicer default message.
assertListEqual(self, list1, list2, msg=None)
A list-specific equality assertion.
 
Args:
    list1: The first list to compare.
    list2: The second list to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assertMultiLineEqual(self, first, second, msg=None)
Assert that two multi-line strings are equal.
assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotAlmostEquals = assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotEquals = assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotIn(self, member, container, msg=None)
Just like assertTrue(a not in b), but with a nicer default message.
assertNotIsInstance(self, obj, cls, msg=None)
Included for symmetry with assertIsInstance.
assertNotRegexpMatches(self, text, unexpected_regexp, msg=None)
Fail the test if the text matches the regular expression.
assertRaises(self, excClass, callableObj=None, *args, **kwargs)
Fail unless an exception of class excClass is thrown
by callableObj when invoked with arguments args and keyword
arguments kwargs. If a different type of exception is
thrown, it will not be caught, and the test case will be
deemed to have suffered an error, exactly as for an
unexpected exception.
 
If called with callableObj omitted or None, will return a
context object used like this::
 
     with assertRaises(SomeException):
         do_something()
 
The context manager keeps a reference to the exception as
the 'exception' attribute. This allows you to inspect the
exception after the assertion::
 
    with assertRaises(SomeException) as cm:
        do_something()
    the_exception = cm.exception
    assertEqual(the_exception.error_code, 3)
assertRaisesRegexp(self, expected_exception, expected_regexp, callable_obj=None, *args, **kwargs)
Asserts that the message in a raised exception matches a regexp.
 
Args:
    expected_exception: Exception class expected to be raised.
    expected_regexp: Regexp (re pattern object or string) expected
            to be found in error message.
    callable_obj: Function to be called.
    args: Extra args.
    kwargs: Extra kwargs.
assertRegexpMatches(self, text, expected_regexp, msg=None)
Fail the test unless the text matches the regular expression.
assertSequenceEqual(self, seq1, seq2, msg=None, seq_type=None)
An equality assertion for ordered sequences (like lists and tuples).
 
For the purposes of this function, a valid ordered sequence type is one
which can be indexed, has a length, and has an equality operator.
 
Args:
    seq1: The first sequence to compare.
    seq2: The second sequence to compare.
    seq_type: The expected datatype of the sequences, or None if no
            datatype should be enforced.
    msg: Optional message to use on failure instead of a list of
            differences.
assertSetEqual(self, set1, set2, msg=None)
A set-specific equality assertion.
 
Args:
    set1: The first set to compare.
    set2: The second set to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
 
assertSetEqual uses ducktyping to support different types of sets, and
is optimized for sets specifically (parameters must support a
difference method).
assertTrue(self, expr, msg=None)
Check that the expression is true.
assertTupleEqual(self, tuple1, tuple2, msg=None)
A tuple-specific equality assertion.
 
Args:
    tuple1: The first tuple to compare.
    tuple2: The second tuple to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assert_ = assertTrue(self, expr, msg=None)
Check that the expression is true.
countTestCases(self)
debug(self)
Run the test without collecting errors in a TestResult
defaultTestResult(self)
doCleanups(self)
Execute all cleanup functions. Normally called for you after
tearDown.
fail(self, msg=None)
Fail immediately, with the given message.
failIf = deprecated_func(*args, **kwargs)
failIfAlmostEqual = deprecated_func(*args, **kwargs)
failIfEqual = deprecated_func(*args, **kwargs)
failUnless = deprecated_func(*args, **kwargs)
failUnlessAlmostEqual = deprecated_func(*args, **kwargs)
failUnlessEqual = deprecated_func(*args, **kwargs)
failUnlessRaises = deprecated_func(*args, **kwargs)
id(self)
run(self, result=None)
shortDescription(self)
Returns a one-line description of the test, or None if no
description has been provided.
 
The default implementation of this method returns the first line of
the specified test method's docstring.
skipTest(self, reason)
Skip this test.
tearDown(self)
Hook method for deconstructing the test fixture after testing it.

Class methods inherited from unittest.case.TestCase:
setUpClass(cls) from __builtin__.type
Hook method for setting up class fixture before running tests in the class.
tearDownClass(cls) from __builtin__.type
Hook method for deconstructing the class fixture after running all tests in the class.

Data descriptors inherited from unittest.case.TestCase:
__dict__
dictionary for instance variables (if defined)
__weakref__
list of weak references to the object (if defined)

Data and other attributes inherited from unittest.case.TestCase:
failureException = <type 'exceptions.AssertionError'>
Assertion failed.
longMessage = False
maxDiff = 640

 
class test_fasta_alignment(unittest.case.TestCase)
    
Method resolution order:
test_fasta_alignment
unittest.case.TestCase
__builtin__.object

Methods defined here:
setUp(self)
test__str__(self)
test_copy(self)
test_error(self)
test_format(self)

Methods inherited from unittest.case.TestCase:
__call__(self, *args, **kwds)
__eq__(self, other)
__hash__(self)
__init__(self, methodName='runTest')
Create an instance of the class that will use the named test
method when executed. Raises a ValueError if the instance does
not have a method with the specified name.
__ne__(self, other)
__repr__(self)
__str__(self)
addCleanup(self, function, *args, **kwargs)
Add a function, with arguments, to be called when the test is
completed. Functions added are called on a LIFO basis and are
called after tearDown on test failure or success.
 
Cleanup items are called even if setUp fails (unlike tearDown).
addTypeEqualityFunc(self, typeobj, function)
Add a type specific assertEqual style function to compare a type.
 
This method is for use by TestCase subclasses that need to register
their own type equality functions to provide nicer error messages.
 
Args:
    typeobj: The data type to call this function on when both values
            are of the same type in assertEqual().
    function: The callable taking two arguments and an optional
            msg= argument that raises self.failureException with a
            useful error message when the two arguments are not equal.
assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertAlmostEquals = assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertDictContainsSubset(self, expected, actual, msg=None)
Checks whether actual is a superset of expected.
assertDictEqual(self, d1, d2, msg=None)
assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertEquals = assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertFalse(self, expr, msg=None)
Check that the expression is false.
assertGreater(self, a, b, msg=None)
Just like assertTrue(a > b), but with a nicer default message.
assertGreaterEqual(self, a, b, msg=None)
Just like assertTrue(a >= b), but with a nicer default message.
assertIn(self, member, container, msg=None)
Just like assertTrue(a in b), but with a nicer default message.
assertIs(self, expr1, expr2, msg=None)
Just like assertTrue(a is b), but with a nicer default message.
assertIsInstance(self, obj, cls, msg=None)
Same as assertTrue(isinstance(obj, cls)), with a nicer
default message.
assertIsNone(self, obj, msg=None)
Same as assertTrue(obj is None), with a nicer default message.
assertIsNot(self, expr1, expr2, msg=None)
Just like assertTrue(a is not b), but with a nicer default message.
assertIsNotNone(self, obj, msg=None)
Included for symmetry with assertIsNone.
assertItemsEqual(self, expected_seq, actual_seq, msg=None)
An unordered sequence specific comparison. It asserts that
actual_seq and expected_seq have the same element counts.
Equivalent to::
 
    assertEqual(Counter(iter(actual_seq)),
                     Counter(iter(expected_seq)))
 
Asserts that each element has the same count in both sequences.
Example:
    - [0, 1, 1] and [1, 0, 1] compare equal.
    - [0, 0, 1] and [0, 1] compare unequal.
assertLess(self, a, b, msg=None)
Just like assertTrue(a < b), but with a nicer default message.
assertLessEqual(self, a, b, msg=None)
Just like assertTrue(a <= b), but with a nicer default message.
assertListEqual(self, list1, list2, msg=None)
A list-specific equality assertion.
 
Args:
    list1: The first list to compare.
    list2: The second list to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assertMultiLineEqual(self, first, second, msg=None)
Assert that two multi-line strings are equal.
assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotAlmostEquals = assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotEquals = assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotIn(self, member, container, msg=None)
Just like assertTrue(a not in b), but with a nicer default message.
assertNotIsInstance(self, obj, cls, msg=None)
Included for symmetry with assertIsInstance.
assertNotRegexpMatches(self, text, unexpected_regexp, msg=None)
Fail the test if the text matches the regular expression.
assertRaises(self, excClass, callableObj=None, *args, **kwargs)
Fail unless an exception of class excClass is thrown
by callableObj when invoked with arguments args and keyword
arguments kwargs. If a different type of exception is
thrown, it will not be caught, and the test case will be
deemed to have suffered an error, exactly as for an
unexpected exception.
 
If called with callableObj omitted or None, will return a
context object used like this::
 
     with assertRaises(SomeException):
         do_something()
 
The context manager keeps a reference to the exception as
the 'exception' attribute. This allows you to inspect the
exception after the assertion::
 
    with assertRaises(SomeException) as cm:
        do_something()
    the_exception = cm.exception
    assertEqual(the_exception.error_code, 3)
assertRaisesRegexp(self, expected_exception, expected_regexp, callable_obj=None, *args, **kwargs)
Asserts that the message in a raised exception matches a regexp.
 
Args:
    expected_exception: Exception class expected to be raised.
    expected_regexp: Regexp (re pattern object or string) expected
            to be found in error message.
    callable_obj: Function to be called.
    args: Extra args.
    kwargs: Extra kwargs.
assertRegexpMatches(self, text, expected_regexp, msg=None)
Fail the test unless the text matches the regular expression.
assertSequenceEqual(self, seq1, seq2, msg=None, seq_type=None)
An equality assertion for ordered sequences (like lists and tuples).
 
For the purposes of this function, a valid ordered sequence type is one
which can be indexed, has a length, and has an equality operator.
 
Args:
    seq1: The first sequence to compare.
    seq2: The second sequence to compare.
    seq_type: The expected datatype of the sequences, or None if no
            datatype should be enforced.
    msg: Optional message to use on failure instead of a list of
            differences.
assertSetEqual(self, set1, set2, msg=None)
A set-specific equality assertion.
 
Args:
    set1: The first set to compare.
    set2: The second set to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
 
assertSetEqual uses ducktyping to support different types of sets, and
is optimized for sets specifically (parameters must support a
difference method).
assertTrue(self, expr, msg=None)
Check that the expression is true.
assertTupleEqual(self, tuple1, tuple2, msg=None)
A tuple-specific equality assertion.
 
Args:
    tuple1: The first tuple to compare.
    tuple2: The second tuple to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assert_ = assertTrue(self, expr, msg=None)
Check that the expression is true.
countTestCases(self)
debug(self)
Run the test without collecting errors in a TestResult
defaultTestResult(self)
doCleanups(self)
Execute all cleanup functions. Normally called for you after
tearDown.
fail(self, msg=None)
Fail immediately, with the given message.
failIf = deprecated_func(*args, **kwargs)
failIfAlmostEqual = deprecated_func(*args, **kwargs)
failIfEqual = deprecated_func(*args, **kwargs)
failUnless = deprecated_func(*args, **kwargs)
failUnlessAlmostEqual = deprecated_func(*args, **kwargs)
failUnlessEqual = deprecated_func(*args, **kwargs)
failUnlessRaises = deprecated_func(*args, **kwargs)
id(self)
run(self, result=None)
shortDescription(self)
Returns a one-line description of the test, or None if no
description has been provided.
 
The default implementation of this method returns the first line of
the specified test method's docstring.
skipTest(self, reason)
Skip this test.
tearDown(self)
Hook method for deconstructing the test fixture after testing it.

Class methods inherited from unittest.case.TestCase:
setUpClass(cls) from __builtin__.type
Hook method for setting up class fixture before running tests in the class.
tearDownClass(cls) from __builtin__.type
Hook method for deconstructing the class fixture after running all tests in the class.

Data descriptors inherited from unittest.case.TestCase:
__dict__
dictionary for instance variables (if defined)
__weakref__
list of weak references to the object (if defined)

Data and other attributes inherited from unittest.case.TestCase:
failureException = <type 'exceptions.AssertionError'>
Assertion failed.
longMessage = False
maxDiff = 640

 
class test_fasta_sequence(unittest.case.TestCase)
    
Method resolution order:
test_fasta_sequence
unittest.case.TestCase
__builtin__.object

Methods defined here:
setUp(self)
testFormat(self)
testStr(self)

Methods inherited from unittest.case.TestCase:
__call__(self, *args, **kwds)
__eq__(self, other)
__hash__(self)
__init__(self, methodName='runTest')
Create an instance of the class that will use the named test
method when executed. Raises a ValueError if the instance does
not have a method with the specified name.
__ne__(self, other)
__repr__(self)
__str__(self)
addCleanup(self, function, *args, **kwargs)
Add a function, with arguments, to be called when the test is
completed. Functions added are called on a LIFO basis and are
called after tearDown on test failure or success.
 
Cleanup items are called even if setUp fails (unlike tearDown).
addTypeEqualityFunc(self, typeobj, function)
Add a type specific assertEqual style function to compare a type.
 
This method is for use by TestCase subclasses that need to register
their own type equality functions to provide nicer error messages.
 
Args:
    typeobj: The data type to call this function on when both values
            are of the same type in assertEqual().
    function: The callable taking two arguments and an optional
            msg= argument that raises self.failureException with a
            useful error message when the two arguments are not equal.
assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertAlmostEquals = assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertDictContainsSubset(self, expected, actual, msg=None)
Checks whether actual is a superset of expected.
assertDictEqual(self, d1, d2, msg=None)
assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertEquals = assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertFalse(self, expr, msg=None)
Check that the expression is false.
assertGreater(self, a, b, msg=None)
Just like assertTrue(a > b), but with a nicer default message.
assertGreaterEqual(self, a, b, msg=None)
Just like assertTrue(a >= b), but with a nicer default message.
assertIn(self, member, container, msg=None)
Just like assertTrue(a in b), but with a nicer default message.
assertIs(self, expr1, expr2, msg=None)
Just like assertTrue(a is b), but with a nicer default message.
assertIsInstance(self, obj, cls, msg=None)
Same as assertTrue(isinstance(obj, cls)), with a nicer
default message.
assertIsNone(self, obj, msg=None)
Same as assertTrue(obj is None), with a nicer default message.
assertIsNot(self, expr1, expr2, msg=None)
Just like assertTrue(a is not b), but with a nicer default message.
assertIsNotNone(self, obj, msg=None)
Included for symmetry with assertIsNone.
assertItemsEqual(self, expected_seq, actual_seq, msg=None)
An unordered sequence specific comparison. It asserts that
actual_seq and expected_seq have the same element counts.
Equivalent to::
 
    assertEqual(Counter(iter(actual_seq)),
                     Counter(iter(expected_seq)))
 
Asserts that each element has the same count in both sequences.
Example:
    - [0, 1, 1] and [1, 0, 1] compare equal.
    - [0, 0, 1] and [0, 1] compare unequal.
assertLess(self, a, b, msg=None)
Just like assertTrue(a < b), but with a nicer default message.
assertLessEqual(self, a, b, msg=None)
Just like assertTrue(a <= b), but with a nicer default message.
assertListEqual(self, list1, list2, msg=None)
A list-specific equality assertion.
 
Args:
    list1: The first list to compare.
    list2: The second list to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assertMultiLineEqual(self, first, second, msg=None)
Assert that two multi-line strings are equal.
assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotAlmostEquals = assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotEquals = assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotIn(self, member, container, msg=None)
Just like assertTrue(a not in b), but with a nicer default message.
assertNotIsInstance(self, obj, cls, msg=None)
Included for symmetry with assertIsInstance.
assertNotRegexpMatches(self, text, unexpected_regexp, msg=None)
Fail the test if the text matches the regular expression.
assertRaises(self, excClass, callableObj=None, *args, **kwargs)
Fail unless an exception of class excClass is thrown
by callableObj when invoked with arguments args and keyword
arguments kwargs. If a different type of exception is
thrown, it will not be caught, and the test case will be
deemed to have suffered an error, exactly as for an
unexpected exception.
 
If called with callableObj omitted or None, will return a
context object used like this::
 
     with assertRaises(SomeException):
         do_something()
 
The context manager keeps a reference to the exception as
the 'exception' attribute. This allows you to inspect the
exception after the assertion::
 
    with assertRaises(SomeException) as cm:
        do_something()
    the_exception = cm.exception
    assertEqual(the_exception.error_code, 3)
assertRaisesRegexp(self, expected_exception, expected_regexp, callable_obj=None, *args, **kwargs)
Asserts that the message in a raised exception matches a regexp.
 
Args:
    expected_exception: Exception class expected to be raised.
    expected_regexp: Regexp (re pattern object or string) expected
            to be found in error message.
    callable_obj: Function to be called.
    args: Extra args.
    kwargs: Extra kwargs.
assertRegexpMatches(self, text, expected_regexp, msg=None)
Fail the test unless the text matches the regular expression.
assertSequenceEqual(self, seq1, seq2, msg=None, seq_type=None)
An equality assertion for ordered sequences (like lists and tuples).
 
For the purposes of this function, a valid ordered sequence type is one
which can be indexed, has a length, and has an equality operator.
 
Args:
    seq1: The first sequence to compare.
    seq2: The second sequence to compare.
    seq_type: The expected datatype of the sequences, or None if no
            datatype should be enforced.
    msg: Optional message to use on failure instead of a list of
            differences.
assertSetEqual(self, set1, set2, msg=None)
A set-specific equality assertion.
 
Args:
    set1: The first set to compare.
    set2: The second set to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
 
assertSetEqual uses ducktyping to support different types of sets, and
is optimized for sets specifically (parameters must support a
difference method).
assertTrue(self, expr, msg=None)
Check that the expression is true.
assertTupleEqual(self, tuple1, tuple2, msg=None)
A tuple-specific equality assertion.
 
Args:
    tuple1: The first tuple to compare.
    tuple2: The second tuple to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assert_ = assertTrue(self, expr, msg=None)
Check that the expression is true.
countTestCases(self)
debug(self)
Run the test without collecting errors in a TestResult
defaultTestResult(self)
doCleanups(self)
Execute all cleanup functions. Normally called for you after
tearDown.
fail(self, msg=None)
Fail immediately, with the given message.
failIf = deprecated_func(*args, **kwargs)
failIfAlmostEqual = deprecated_func(*args, **kwargs)
failIfEqual = deprecated_func(*args, **kwargs)
failUnless = deprecated_func(*args, **kwargs)
failUnlessAlmostEqual = deprecated_func(*args, **kwargs)
failUnlessEqual = deprecated_func(*args, **kwargs)
failUnlessRaises = deprecated_func(*args, **kwargs)
id(self)
run(self, result=None)
shortDescription(self)
Returns a one-line description of the test, or None if no
description has been provided.
 
The default implementation of this method returns the first line of
the specified test method's docstring.
skipTest(self, reason)
Skip this test.
tearDown(self)
Hook method for deconstructing the test fixture after testing it.

Class methods inherited from unittest.case.TestCase:
setUpClass(cls) from __builtin__.type
Hook method for setting up class fixture before running tests in the class.
tearDownClass(cls) from __builtin__.type
Hook method for deconstructing the class fixture after running all tests in the class.

Data descriptors inherited from unittest.case.TestCase:
__dict__
dictionary for instance variables (if defined)
__weakref__
list of weak references to the object (if defined)

Data and other attributes inherited from unittest.case.TestCase:
failureException = <type 'exceptions.AssertionError'>
Assertion failed.
longMessage = False
maxDiff = 640

 
class test_hhalign_parser(unittest.case.TestCase)
    
Method resolution order:
test_hhalign_parser
unittest.case.TestCase
__builtin__.object

Methods defined here:
assertIterablesAlmostEqual(self, i1, i2, digits)
setUp(self)
test_process_header(self)
test_process_hits(self)

Methods inherited from unittest.case.TestCase:
__call__(self, *args, **kwds)
__eq__(self, other)
__hash__(self)
__init__(self, methodName='runTest')
Create an instance of the class that will use the named test
method when executed. Raises a ValueError if the instance does
not have a method with the specified name.
__ne__(self, other)
__repr__(self)
__str__(self)
addCleanup(self, function, *args, **kwargs)
Add a function, with arguments, to be called when the test is
completed. Functions added are called on a LIFO basis and are
called after tearDown on test failure or success.
 
Cleanup items are called even if setUp fails (unlike tearDown).
addTypeEqualityFunc(self, typeobj, function)
Add a type specific assertEqual style function to compare a type.
 
This method is for use by TestCase subclasses that need to register
their own type equality functions to provide nicer error messages.
 
Args:
    typeobj: The data type to call this function on when both values
            are of the same type in assertEqual().
    function: The callable taking two arguments and an optional
            msg= argument that raises self.failureException with a
            useful error message when the two arguments are not equal.
assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertAlmostEquals = assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertDictContainsSubset(self, expected, actual, msg=None)
Checks whether actual is a superset of expected.
assertDictEqual(self, d1, d2, msg=None)
assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertEquals = assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertFalse(self, expr, msg=None)
Check that the expression is false.
assertGreater(self, a, b, msg=None)
Just like assertTrue(a > b), but with a nicer default message.
assertGreaterEqual(self, a, b, msg=None)
Just like assertTrue(a >= b), but with a nicer default message.
assertIn(self, member, container, msg=None)
Just like assertTrue(a in b), but with a nicer default message.
assertIs(self, expr1, expr2, msg=None)
Just like assertTrue(a is b), but with a nicer default message.
assertIsInstance(self, obj, cls, msg=None)
Same as assertTrue(isinstance(obj, cls)), with a nicer
default message.
assertIsNone(self, obj, msg=None)
Same as assertTrue(obj is None), with a nicer default message.
assertIsNot(self, expr1, expr2, msg=None)
Just like assertTrue(a is not b), but with a nicer default message.
assertIsNotNone(self, obj, msg=None)
Included for symmetry with assertIsNone.
assertItemsEqual(self, expected_seq, actual_seq, msg=None)
An unordered sequence specific comparison. It asserts that
actual_seq and expected_seq have the same element counts.
Equivalent to::
 
    assertEqual(Counter(iter(actual_seq)),
                     Counter(iter(expected_seq)))
 
Asserts that each element has the same count in both sequences.
Example:
    - [0, 1, 1] and [1, 0, 1] compare equal.
    - [0, 0, 1] and [0, 1] compare unequal.
assertLess(self, a, b, msg=None)
Just like assertTrue(a < b), but with a nicer default message.
assertLessEqual(self, a, b, msg=None)
Just like assertTrue(a <= b), but with a nicer default message.
assertListEqual(self, list1, list2, msg=None)
A list-specific equality assertion.
 
Args:
    list1: The first list to compare.
    list2: The second list to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assertMultiLineEqual(self, first, second, msg=None)
Assert that two multi-line strings are equal.
assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotAlmostEquals = assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotEquals = assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotIn(self, member, container, msg=None)
Just like assertTrue(a not in b), but with a nicer default message.
assertNotIsInstance(self, obj, cls, msg=None)
Included for symmetry with assertIsInstance.
assertNotRegexpMatches(self, text, unexpected_regexp, msg=None)
Fail the test if the text matches the regular expression.
assertRaises(self, excClass, callableObj=None, *args, **kwargs)
Fail unless an exception of class excClass is thrown
by callableObj when invoked with arguments args and keyword
arguments kwargs. If a different type of exception is
thrown, it will not be caught, and the test case will be
deemed to have suffered an error, exactly as for an
unexpected exception.
 
If called with callableObj omitted or None, will return a
context object used like this::
 
     with assertRaises(SomeException):
         do_something()
 
The context manager keeps a reference to the exception as
the 'exception' attribute. This allows you to inspect the
exception after the assertion::
 
    with assertRaises(SomeException) as cm:
        do_something()
    the_exception = cm.exception
    assertEqual(the_exception.error_code, 3)
assertRaisesRegexp(self, expected_exception, expected_regexp, callable_obj=None, *args, **kwargs)
Asserts that the message in a raised exception matches a regexp.
 
Args:
    expected_exception: Exception class expected to be raised.
    expected_regexp: Regexp (re pattern object or string) expected
            to be found in error message.
    callable_obj: Function to be called.
    args: Extra args.
    kwargs: Extra kwargs.
assertRegexpMatches(self, text, expected_regexp, msg=None)
Fail the test unless the text matches the regular expression.
assertSequenceEqual(self, seq1, seq2, msg=None, seq_type=None)
An equality assertion for ordered sequences (like lists and tuples).
 
For the purposes of this function, a valid ordered sequence type is one
which can be indexed, has a length, and has an equality operator.
 
Args:
    seq1: The first sequence to compare.
    seq2: The second sequence to compare.
    seq_type: The expected datatype of the sequences, or None if no
            datatype should be enforced.
    msg: Optional message to use on failure instead of a list of
            differences.
assertSetEqual(self, set1, set2, msg=None)
A set-specific equality assertion.
 
Args:
    set1: The first set to compare.
    set2: The second set to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
 
assertSetEqual uses ducktyping to support different types of sets, and
is optimized for sets specifically (parameters must support a
difference method).
assertTrue(self, expr, msg=None)
Check that the expression is true.
assertTupleEqual(self, tuple1, tuple2, msg=None)
A tuple-specific equality assertion.
 
Args:
    tuple1: The first tuple to compare.
    tuple2: The second tuple to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assert_ = assertTrue(self, expr, msg=None)
Check that the expression is true.
countTestCases(self)
debug(self)
Run the test without collecting errors in a TestResult
defaultTestResult(self)
doCleanups(self)
Execute all cleanup functions. Normally called for you after
tearDown.
fail(self, msg=None)
Fail immediately, with the given message.
failIf = deprecated_func(*args, **kwargs)
failIfAlmostEqual = deprecated_func(*args, **kwargs)
failIfEqual = deprecated_func(*args, **kwargs)
failUnless = deprecated_func(*args, **kwargs)
failUnlessAlmostEqual = deprecated_func(*args, **kwargs)
failUnlessEqual = deprecated_func(*args, **kwargs)
failUnlessRaises = deprecated_func(*args, **kwargs)
id(self)
run(self, result=None)
shortDescription(self)
Returns a one-line description of the test, or None if no
description has been provided.
 
The default implementation of this method returns the first line of
the specified test method's docstring.
skipTest(self, reason)
Skip this test.
tearDown(self)
Hook method for deconstructing the test fixture after testing it.

Class methods inherited from unittest.case.TestCase:
setUpClass(cls) from __builtin__.type
Hook method for setting up class fixture before running tests in the class.
tearDownClass(cls) from __builtin__.type
Hook method for deconstructing the class fixture after running all tests in the class.

Data descriptors inherited from unittest.case.TestCase:
__dict__
dictionary for instance variables (if defined)
__weakref__
list of weak references to the object (if defined)

Data and other attributes inherited from unittest.case.TestCase:
failureException = <type 'exceptions.AssertionError'>
Assertion failed.
longMessage = False
maxDiff = 640

 
class test_hhsearch_parser(unittest.case.TestCase)
    
Method resolution order:
test_hhsearch_parser
unittest.case.TestCase
__builtin__.object

Methods defined here:
assertIterablesAlmostEqual(self, i1, i2, digits)
setUp(self)
test_process_header(self)
test_process_hits(self)

Methods inherited from unittest.case.TestCase:
__call__(self, *args, **kwds)
__eq__(self, other)
__hash__(self)
__init__(self, methodName='runTest')
Create an instance of the class that will use the named test
method when executed. Raises a ValueError if the instance does
not have a method with the specified name.
__ne__(self, other)
__repr__(self)
__str__(self)
addCleanup(self, function, *args, **kwargs)
Add a function, with arguments, to be called when the test is
completed. Functions added are called on a LIFO basis and are
called after tearDown on test failure or success.
 
Cleanup items are called even if setUp fails (unlike tearDown).
addTypeEqualityFunc(self, typeobj, function)
Add a type specific assertEqual style function to compare a type.
 
This method is for use by TestCase subclasses that need to register
their own type equality functions to provide nicer error messages.
 
Args:
    typeobj: The data type to call this function on when both values
            are of the same type in assertEqual().
    function: The callable taking two arguments and an optional
            msg= argument that raises self.failureException with a
            useful error message when the two arguments are not equal.
assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertAlmostEquals = assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertDictContainsSubset(self, expected, actual, msg=None)
Checks whether actual is a superset of expected.
assertDictEqual(self, d1, d2, msg=None)
assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertEquals = assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertFalse(self, expr, msg=None)
Check that the expression is false.
assertGreater(self, a, b, msg=None)
Just like assertTrue(a > b), but with a nicer default message.
assertGreaterEqual(self, a, b, msg=None)
Just like assertTrue(a >= b), but with a nicer default message.
assertIn(self, member, container, msg=None)
Just like assertTrue(a in b), but with a nicer default message.
assertIs(self, expr1, expr2, msg=None)
Just like assertTrue(a is b), but with a nicer default message.
assertIsInstance(self, obj, cls, msg=None)
Same as assertTrue(isinstance(obj, cls)), with a nicer
default message.
assertIsNone(self, obj, msg=None)
Same as assertTrue(obj is None), with a nicer default message.
assertIsNot(self, expr1, expr2, msg=None)
Just like assertTrue(a is not b), but with a nicer default message.
assertIsNotNone(self, obj, msg=None)
Included for symmetry with assertIsNone.
assertItemsEqual(self, expected_seq, actual_seq, msg=None)
An unordered sequence specific comparison. It asserts that
actual_seq and expected_seq have the same element counts.
Equivalent to::
 
    assertEqual(Counter(iter(actual_seq)),
                     Counter(iter(expected_seq)))
 
Asserts that each element has the same count in both sequences.
Example:
    - [0, 1, 1] and [1, 0, 1] compare equal.
    - [0, 0, 1] and [0, 1] compare unequal.
assertLess(self, a, b, msg=None)
Just like assertTrue(a < b), but with a nicer default message.
assertLessEqual(self, a, b, msg=None)
Just like assertTrue(a <= b), but with a nicer default message.
assertListEqual(self, list1, list2, msg=None)
A list-specific equality assertion.
 
Args:
    list1: The first list to compare.
    list2: The second list to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assertMultiLineEqual(self, first, second, msg=None)
Assert that two multi-line strings are equal.
assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotAlmostEquals = assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotEquals = assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotIn(self, member, container, msg=None)
Just like assertTrue(a not in b), but with a nicer default message.
assertNotIsInstance(self, obj, cls, msg=None)
Included for symmetry with assertIsInstance.
assertNotRegexpMatches(self, text, unexpected_regexp, msg=None)
Fail the test if the text matches the regular expression.
assertRaises(self, excClass, callableObj=None, *args, **kwargs)
Fail unless an exception of class excClass is thrown
by callableObj when invoked with arguments args and keyword
arguments kwargs. If a different type of exception is
thrown, it will not be caught, and the test case will be
deemed to have suffered an error, exactly as for an
unexpected exception.
 
If called with callableObj omitted or None, will return a
context object used like this::
 
     with assertRaises(SomeException):
         do_something()
 
The context manager keeps a reference to the exception as
the 'exception' attribute. This allows you to inspect the
exception after the assertion::
 
    with assertRaises(SomeException) as cm:
        do_something()
    the_exception = cm.exception
    assertEqual(the_exception.error_code, 3)
assertRaisesRegexp(self, expected_exception, expected_regexp, callable_obj=None, *args, **kwargs)
Asserts that the message in a raised exception matches a regexp.
 
Args:
    expected_exception: Exception class expected to be raised.
    expected_regexp: Regexp (re pattern object or string) expected
            to be found in error message.
    callable_obj: Function to be called.
    args: Extra args.
    kwargs: Extra kwargs.
assertRegexpMatches(self, text, expected_regexp, msg=None)
Fail the test unless the text matches the regular expression.
assertSequenceEqual(self, seq1, seq2, msg=None, seq_type=None)
An equality assertion for ordered sequences (like lists and tuples).
 
For the purposes of this function, a valid ordered sequence type is one
which can be indexed, has a length, and has an equality operator.
 
Args:
    seq1: The first sequence to compare.
    seq2: The second sequence to compare.
    seq_type: The expected datatype of the sequences, or None if no
            datatype should be enforced.
    msg: Optional message to use on failure instead of a list of
            differences.
assertSetEqual(self, set1, set2, msg=None)
A set-specific equality assertion.
 
Args:
    set1: The first set to compare.
    set2: The second set to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
 
assertSetEqual uses ducktyping to support different types of sets, and
is optimized for sets specifically (parameters must support a
difference method).
assertTrue(self, expr, msg=None)
Check that the expression is true.
assertTupleEqual(self, tuple1, tuple2, msg=None)
A tuple-specific equality assertion.
 
Args:
    tuple1: The first tuple to compare.
    tuple2: The second tuple to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assert_ = assertTrue(self, expr, msg=None)
Check that the expression is true.
countTestCases(self)
debug(self)
Run the test without collecting errors in a TestResult
defaultTestResult(self)
doCleanups(self)
Execute all cleanup functions. Normally called for you after
tearDown.
fail(self, msg=None)
Fail immediately, with the given message.
failIf = deprecated_func(*args, **kwargs)
failIfAlmostEqual = deprecated_func(*args, **kwargs)
failIfEqual = deprecated_func(*args, **kwargs)
failUnless = deprecated_func(*args, **kwargs)
failUnlessAlmostEqual = deprecated_func(*args, **kwargs)
failUnlessEqual = deprecated_func(*args, **kwargs)
failUnlessRaises = deprecated_func(*args, **kwargs)
id(self)
run(self, result=None)
shortDescription(self)
Returns a one-line description of the test, or None if no
description has been provided.
 
The default implementation of this method returns the first line of
the specified test method's docstring.
skipTest(self, reason)
Skip this test.
tearDown(self)
Hook method for deconstructing the test fixture after testing it.

Class methods inherited from unittest.case.TestCase:
setUpClass(cls) from __builtin__.type
Hook method for setting up class fixture before running tests in the class.
tearDownClass(cls) from __builtin__.type
Hook method for deconstructing the class fixture after running all tests in the class.

Data descriptors inherited from unittest.case.TestCase:
__dict__
dictionary for instance variables (if defined)
__weakref__
list of weak references to the object (if defined)

Data and other attributes inherited from unittest.case.TestCase:
failureException = <type 'exceptions.AssertionError'>
Assertion failed.
longMessage = False
maxDiff = 640

 
class test_midline(unittest.case.TestCase)
    
Method resolution order:
test_midline
unittest.case.TestCase
__builtin__.object

Methods defined here:
setUp(self)
testConservationCode(self)
testMidline(self)

Methods inherited from unittest.case.TestCase:
__call__(self, *args, **kwds)
__eq__(self, other)
__hash__(self)
__init__(self, methodName='runTest')
Create an instance of the class that will use the named test
method when executed. Raises a ValueError if the instance does
not have a method with the specified name.
__ne__(self, other)
__repr__(self)
__str__(self)
addCleanup(self, function, *args, **kwargs)
Add a function, with arguments, to be called when the test is
completed. Functions added are called on a LIFO basis and are
called after tearDown on test failure or success.
 
Cleanup items are called even if setUp fails (unlike tearDown).
addTypeEqualityFunc(self, typeobj, function)
Add a type specific assertEqual style function to compare a type.
 
This method is for use by TestCase subclasses that need to register
their own type equality functions to provide nicer error messages.
 
Args:
    typeobj: The data type to call this function on when both values
            are of the same type in assertEqual().
    function: The callable taking two arguments and an optional
            msg= argument that raises self.failureException with a
            useful error message when the two arguments are not equal.
assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertAlmostEquals = assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertDictContainsSubset(self, expected, actual, msg=None)
Checks whether actual is a superset of expected.
assertDictEqual(self, d1, d2, msg=None)
assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertEquals = assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertFalse(self, expr, msg=None)
Check that the expression is false.
assertGreater(self, a, b, msg=None)
Just like assertTrue(a > b), but with a nicer default message.
assertGreaterEqual(self, a, b, msg=None)
Just like assertTrue(a >= b), but with a nicer default message.
assertIn(self, member, container, msg=None)
Just like assertTrue(a in b), but with a nicer default message.
assertIs(self, expr1, expr2, msg=None)
Just like assertTrue(a is b), but with a nicer default message.
assertIsInstance(self, obj, cls, msg=None)
Same as assertTrue(isinstance(obj, cls)), with a nicer
default message.
assertIsNone(self, obj, msg=None)
Same as assertTrue(obj is None), with a nicer default message.
assertIsNot(self, expr1, expr2, msg=None)
Just like assertTrue(a is not b), but with a nicer default message.
assertIsNotNone(self, obj, msg=None)
Included for symmetry with assertIsNone.
assertItemsEqual(self, expected_seq, actual_seq, msg=None)
An unordered sequence specific comparison. It asserts that
actual_seq and expected_seq have the same element counts.
Equivalent to::
 
    assertEqual(Counter(iter(actual_seq)),
                     Counter(iter(expected_seq)))
 
Asserts that each element has the same count in both sequences.
Example:
    - [0, 1, 1] and [1, 0, 1] compare equal.
    - [0, 0, 1] and [0, 1] compare unequal.
assertLess(self, a, b, msg=None)
Just like assertTrue(a < b), but with a nicer default message.
assertLessEqual(self, a, b, msg=None)
Just like assertTrue(a <= b), but with a nicer default message.
assertListEqual(self, list1, list2, msg=None)
A list-specific equality assertion.
 
Args:
    list1: The first list to compare.
    list2: The second list to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assertMultiLineEqual(self, first, second, msg=None)
Assert that two multi-line strings are equal.
assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotAlmostEquals = assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotEquals = assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotIn(self, member, container, msg=None)
Just like assertTrue(a not in b), but with a nicer default message.
assertNotIsInstance(self, obj, cls, msg=None)
Included for symmetry with assertIsInstance.
assertNotRegexpMatches(self, text, unexpected_regexp, msg=None)
Fail the test if the text matches the regular expression.
assertRaises(self, excClass, callableObj=None, *args, **kwargs)
Fail unless an exception of class excClass is thrown
by callableObj when invoked with arguments args and keyword
arguments kwargs. If a different type of exception is
thrown, it will not be caught, and the test case will be
deemed to have suffered an error, exactly as for an
unexpected exception.
 
If called with callableObj omitted or None, will return a
context object used like this::
 
     with assertRaises(SomeException):
         do_something()
 
The context manager keeps a reference to the exception as
the 'exception' attribute. This allows you to inspect the
exception after the assertion::
 
    with assertRaises(SomeException) as cm:
        do_something()
    the_exception = cm.exception
    assertEqual(the_exception.error_code, 3)
assertRaisesRegexp(self, expected_exception, expected_regexp, callable_obj=None, *args, **kwargs)
Asserts that the message in a raised exception matches a regexp.
 
Args:
    expected_exception: Exception class expected to be raised.
    expected_regexp: Regexp (re pattern object or string) expected
            to be found in error message.
    callable_obj: Function to be called.
    args: Extra args.
    kwargs: Extra kwargs.
assertRegexpMatches(self, text, expected_regexp, msg=None)
Fail the test unless the text matches the regular expression.
assertSequenceEqual(self, seq1, seq2, msg=None, seq_type=None)
An equality assertion for ordered sequences (like lists and tuples).
 
For the purposes of this function, a valid ordered sequence type is one
which can be indexed, has a length, and has an equality operator.
 
Args:
    seq1: The first sequence to compare.
    seq2: The second sequence to compare.
    seq_type: The expected datatype of the sequences, or None if no
            datatype should be enforced.
    msg: Optional message to use on failure instead of a list of
            differences.
assertSetEqual(self, set1, set2, msg=None)
A set-specific equality assertion.
 
Args:
    set1: The first set to compare.
    set2: The second set to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
 
assertSetEqual uses ducktyping to support different types of sets, and
is optimized for sets specifically (parameters must support a
difference method).
assertTrue(self, expr, msg=None)
Check that the expression is true.
assertTupleEqual(self, tuple1, tuple2, msg=None)
A tuple-specific equality assertion.
 
Args:
    tuple1: The first tuple to compare.
    tuple2: The second tuple to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assert_ = assertTrue(self, expr, msg=None)
Check that the expression is true.
countTestCases(self)
debug(self)
Run the test without collecting errors in a TestResult
defaultTestResult(self)
doCleanups(self)
Execute all cleanup functions. Normally called for you after
tearDown.
fail(self, msg=None)
Fail immediately, with the given message.
failIf = deprecated_func(*args, **kwargs)
failIfAlmostEqual = deprecated_func(*args, **kwargs)
failIfEqual = deprecated_func(*args, **kwargs)
failUnless = deprecated_func(*args, **kwargs)
failUnlessAlmostEqual = deprecated_func(*args, **kwargs)
failUnlessEqual = deprecated_func(*args, **kwargs)
failUnlessRaises = deprecated_func(*args, **kwargs)
id(self)
run(self, result=None)
shortDescription(self)
Returns a one-line description of the test, or None if no
description has been provided.
 
The default implementation of this method returns the first line of
the specified test method's docstring.
skipTest(self, reason)
Skip this test.
tearDown(self)
Hook method for deconstructing the test fixture after testing it.

Class methods inherited from unittest.case.TestCase:
setUpClass(cls) from __builtin__.type
Hook method for setting up class fixture before running tests in the class.
tearDownClass(cls) from __builtin__.type
Hook method for deconstructing the class fixture after running all tests in the class.

Data descriptors inherited from unittest.case.TestCase:
__dict__
dictionary for instance variables (if defined)
__weakref__
list of weak references to the object (if defined)

Data and other attributes inherited from unittest.case.TestCase:
failureException = <type 'exceptions.AssertionError'>
Assertion failed.
longMessage = False
maxDiff = 640

 
class test_pir_alignment(unittest.case.TestCase)
    
Method resolution order:
test_pir_alignment
unittest.case.TestCase
__builtin__.object

Methods defined here:
setUp(self)
test__str__(self)
test_copy(self)
test_error(self)
test_format(self)

Methods inherited from unittest.case.TestCase:
__call__(self, *args, **kwds)
__eq__(self, other)
__hash__(self)
__init__(self, methodName='runTest')
Create an instance of the class that will use the named test
method when executed. Raises a ValueError if the instance does
not have a method with the specified name.
__ne__(self, other)
__repr__(self)
__str__(self)
addCleanup(self, function, *args, **kwargs)
Add a function, with arguments, to be called when the test is
completed. Functions added are called on a LIFO basis and are
called after tearDown on test failure or success.
 
Cleanup items are called even if setUp fails (unlike tearDown).
addTypeEqualityFunc(self, typeobj, function)
Add a type specific assertEqual style function to compare a type.
 
This method is for use by TestCase subclasses that need to register
their own type equality functions to provide nicer error messages.
 
Args:
    typeobj: The data type to call this function on when both values
            are of the same type in assertEqual().
    function: The callable taking two arguments and an optional
            msg= argument that raises self.failureException with a
            useful error message when the two arguments are not equal.
assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertAlmostEquals = assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertDictContainsSubset(self, expected, actual, msg=None)
Checks whether actual is a superset of expected.
assertDictEqual(self, d1, d2, msg=None)
assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertEquals = assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertFalse(self, expr, msg=None)
Check that the expression is false.
assertGreater(self, a, b, msg=None)
Just like assertTrue(a > b), but with a nicer default message.
assertGreaterEqual(self, a, b, msg=None)
Just like assertTrue(a >= b), but with a nicer default message.
assertIn(self, member, container, msg=None)
Just like assertTrue(a in b), but with a nicer default message.
assertIs(self, expr1, expr2, msg=None)
Just like assertTrue(a is b), but with a nicer default message.
assertIsInstance(self, obj, cls, msg=None)
Same as assertTrue(isinstance(obj, cls)), with a nicer
default message.
assertIsNone(self, obj, msg=None)
Same as assertTrue(obj is None), with a nicer default message.
assertIsNot(self, expr1, expr2, msg=None)
Just like assertTrue(a is not b), but with a nicer default message.
assertIsNotNone(self, obj, msg=None)
Included for symmetry with assertIsNone.
assertItemsEqual(self, expected_seq, actual_seq, msg=None)
An unordered sequence specific comparison. It asserts that
actual_seq and expected_seq have the same element counts.
Equivalent to::
 
    assertEqual(Counter(iter(actual_seq)),
                     Counter(iter(expected_seq)))
 
Asserts that each element has the same count in both sequences.
Example:
    - [0, 1, 1] and [1, 0, 1] compare equal.
    - [0, 0, 1] and [0, 1] compare unequal.
assertLess(self, a, b, msg=None)
Just like assertTrue(a < b), but with a nicer default message.
assertLessEqual(self, a, b, msg=None)
Just like assertTrue(a <= b), but with a nicer default message.
assertListEqual(self, list1, list2, msg=None)
A list-specific equality assertion.
 
Args:
    list1: The first list to compare.
    list2: The second list to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assertMultiLineEqual(self, first, second, msg=None)
Assert that two multi-line strings are equal.
assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotAlmostEquals = assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotEquals = assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotIn(self, member, container, msg=None)
Just like assertTrue(a not in b), but with a nicer default message.
assertNotIsInstance(self, obj, cls, msg=None)
Included for symmetry with assertIsInstance.
assertNotRegexpMatches(self, text, unexpected_regexp, msg=None)
Fail the test if the text matches the regular expression.
assertRaises(self, excClass, callableObj=None, *args, **kwargs)
Fail unless an exception of class excClass is thrown
by callableObj when invoked with arguments args and keyword
arguments kwargs. If a different type of exception is
thrown, it will not be caught, and the test case will be
deemed to have suffered an error, exactly as for an
unexpected exception.
 
If called with callableObj omitted or None, will return a
context object used like this::
 
     with assertRaises(SomeException):
         do_something()
 
The context manager keeps a reference to the exception as
the 'exception' attribute. This allows you to inspect the
exception after the assertion::
 
    with assertRaises(SomeException) as cm:
        do_something()
    the_exception = cm.exception
    assertEqual(the_exception.error_code, 3)
assertRaisesRegexp(self, expected_exception, expected_regexp, callable_obj=None, *args, **kwargs)
Asserts that the message in a raised exception matches a regexp.
 
Args:
    expected_exception: Exception class expected to be raised.
    expected_regexp: Regexp (re pattern object or string) expected
            to be found in error message.
    callable_obj: Function to be called.
    args: Extra args.
    kwargs: Extra kwargs.
assertRegexpMatches(self, text, expected_regexp, msg=None)
Fail the test unless the text matches the regular expression.
assertSequenceEqual(self, seq1, seq2, msg=None, seq_type=None)
An equality assertion for ordered sequences (like lists and tuples).
 
For the purposes of this function, a valid ordered sequence type is one
which can be indexed, has a length, and has an equality operator.
 
Args:
    seq1: The first sequence to compare.
    seq2: The second sequence to compare.
    seq_type: The expected datatype of the sequences, or None if no
            datatype should be enforced.
    msg: Optional message to use on failure instead of a list of
            differences.
assertSetEqual(self, set1, set2, msg=None)
A set-specific equality assertion.
 
Args:
    set1: The first set to compare.
    set2: The second set to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
 
assertSetEqual uses ducktyping to support different types of sets, and
is optimized for sets specifically (parameters must support a
difference method).
assertTrue(self, expr, msg=None)
Check that the expression is true.
assertTupleEqual(self, tuple1, tuple2, msg=None)
A tuple-specific equality assertion.
 
Args:
    tuple1: The first tuple to compare.
    tuple2: The second tuple to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assert_ = assertTrue(self, expr, msg=None)
Check that the expression is true.
countTestCases(self)
debug(self)
Run the test without collecting errors in a TestResult
defaultTestResult(self)
doCleanups(self)
Execute all cleanup functions. Normally called for you after
tearDown.
fail(self, msg=None)
Fail immediately, with the given message.
failIf = deprecated_func(*args, **kwargs)
failIfAlmostEqual = deprecated_func(*args, **kwargs)
failIfEqual = deprecated_func(*args, **kwargs)
failUnless = deprecated_func(*args, **kwargs)
failUnlessAlmostEqual = deprecated_func(*args, **kwargs)
failUnlessEqual = deprecated_func(*args, **kwargs)
failUnlessRaises = deprecated_func(*args, **kwargs)
id(self)
run(self, result=None)
shortDescription(self)
Returns a one-line description of the test, or None if no
description has been provided.
 
The default implementation of this method returns the first line of
the specified test method's docstring.
skipTest(self, reason)
Skip this test.
tearDown(self)
Hook method for deconstructing the test fixture after testing it.

Class methods inherited from unittest.case.TestCase:
setUpClass(cls) from __builtin__.type
Hook method for setting up class fixture before running tests in the class.
tearDownClass(cls) from __builtin__.type
Hook method for deconstructing the class fixture after running all tests in the class.

Data descriptors inherited from unittest.case.TestCase:
__dict__
dictionary for instance variables (if defined)
__weakref__
list of weak references to the object (if defined)

Data and other attributes inherited from unittest.case.TestCase:
failureException = <type 'exceptions.AssertionError'>
Assertion failed.
longMessage = False
maxDiff = 640

 
class test_pir_sequence(unittest.case.TestCase)
    
Method resolution order:
test_pir_sequence
unittest.case.TestCase
__builtin__.object

Methods defined here:
setUp(self)
testFormat(self)
testStr(self)

Methods inherited from unittest.case.TestCase:
__call__(self, *args, **kwds)
__eq__(self, other)
__hash__(self)
__init__(self, methodName='runTest')
Create an instance of the class that will use the named test
method when executed. Raises a ValueError if the instance does
not have a method with the specified name.
__ne__(self, other)
__repr__(self)
__str__(self)
addCleanup(self, function, *args, **kwargs)
Add a function, with arguments, to be called when the test is
completed. Functions added are called on a LIFO basis and are
called after tearDown on test failure or success.
 
Cleanup items are called even if setUp fails (unlike tearDown).
addTypeEqualityFunc(self, typeobj, function)
Add a type specific assertEqual style function to compare a type.
 
This method is for use by TestCase subclasses that need to register
their own type equality functions to provide nicer error messages.
 
Args:
    typeobj: The data type to call this function on when both values
            are of the same type in assertEqual().
    function: The callable taking two arguments and an optional
            msg= argument that raises self.failureException with a
            useful error message when the two arguments are not equal.
assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertAlmostEquals = assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertDictContainsSubset(self, expected, actual, msg=None)
Checks whether actual is a superset of expected.
assertDictEqual(self, d1, d2, msg=None)
assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertEquals = assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertFalse(self, expr, msg=None)
Check that the expression is false.
assertGreater(self, a, b, msg=None)
Just like assertTrue(a > b), but with a nicer default message.
assertGreaterEqual(self, a, b, msg=None)
Just like assertTrue(a >= b), but with a nicer default message.
assertIn(self, member, container, msg=None)
Just like assertTrue(a in b), but with a nicer default message.
assertIs(self, expr1, expr2, msg=None)
Just like assertTrue(a is b), but with a nicer default message.
assertIsInstance(self, obj, cls, msg=None)
Same as assertTrue(isinstance(obj, cls)), with a nicer
default message.
assertIsNone(self, obj, msg=None)
Same as assertTrue(obj is None), with a nicer default message.
assertIsNot(self, expr1, expr2, msg=None)
Just like assertTrue(a is not b), but with a nicer default message.
assertIsNotNone(self, obj, msg=None)
Included for symmetry with assertIsNone.
assertItemsEqual(self, expected_seq, actual_seq, msg=None)
An unordered sequence specific comparison. It asserts that
actual_seq and expected_seq have the same element counts.
Equivalent to::
 
    assertEqual(Counter(iter(actual_seq)),
                     Counter(iter(expected_seq)))
 
Asserts that each element has the same count in both sequences.
Example:
    - [0, 1, 1] and [1, 0, 1] compare equal.
    - [0, 0, 1] and [0, 1] compare unequal.
assertLess(self, a, b, msg=None)
Just like assertTrue(a < b), but with a nicer default message.
assertLessEqual(self, a, b, msg=None)
Just like assertTrue(a <= b), but with a nicer default message.
assertListEqual(self, list1, list2, msg=None)
A list-specific equality assertion.
 
Args:
    list1: The first list to compare.
    list2: The second list to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assertMultiLineEqual(self, first, second, msg=None)
Assert that two multi-line strings are equal.
assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotAlmostEquals = assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotEquals = assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotIn(self, member, container, msg=None)
Just like assertTrue(a not in b), but with a nicer default message.
assertNotIsInstance(self, obj, cls, msg=None)
Included for symmetry with assertIsInstance.
assertNotRegexpMatches(self, text, unexpected_regexp, msg=None)
Fail the test if the text matches the regular expression.
assertRaises(self, excClass, callableObj=None, *args, **kwargs)
Fail unless an exception of class excClass is thrown
by callableObj when invoked with arguments args and keyword
arguments kwargs. If a different type of exception is
thrown, it will not be caught, and the test case will be
deemed to have suffered an error, exactly as for an
unexpected exception.
 
If called with callableObj omitted or None, will return a
context object used like this::
 
     with assertRaises(SomeException):
         do_something()
 
The context manager keeps a reference to the exception as
the 'exception' attribute. This allows you to inspect the
exception after the assertion::
 
    with assertRaises(SomeException) as cm:
        do_something()
    the_exception = cm.exception
    assertEqual(the_exception.error_code, 3)
assertRaisesRegexp(self, expected_exception, expected_regexp, callable_obj=None, *args, **kwargs)
Asserts that the message in a raised exception matches a regexp.
 
Args:
    expected_exception: Exception class expected to be raised.
    expected_regexp: Regexp (re pattern object or string) expected
            to be found in error message.
    callable_obj: Function to be called.
    args: Extra args.
    kwargs: Extra kwargs.
assertRegexpMatches(self, text, expected_regexp, msg=None)
Fail the test unless the text matches the regular expression.
assertSequenceEqual(self, seq1, seq2, msg=None, seq_type=None)
An equality assertion for ordered sequences (like lists and tuples).
 
For the purposes of this function, a valid ordered sequence type is one
which can be indexed, has a length, and has an equality operator.
 
Args:
    seq1: The first sequence to compare.
    seq2: The second sequence to compare.
    seq_type: The expected datatype of the sequences, or None if no
            datatype should be enforced.
    msg: Optional message to use on failure instead of a list of
            differences.
assertSetEqual(self, set1, set2, msg=None)
A set-specific equality assertion.
 
Args:
    set1: The first set to compare.
    set2: The second set to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
 
assertSetEqual uses ducktyping to support different types of sets, and
is optimized for sets specifically (parameters must support a
difference method).
assertTrue(self, expr, msg=None)
Check that the expression is true.
assertTupleEqual(self, tuple1, tuple2, msg=None)
A tuple-specific equality assertion.
 
Args:
    tuple1: The first tuple to compare.
    tuple2: The second tuple to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assert_ = assertTrue(self, expr, msg=None)
Check that the expression is true.
countTestCases(self)
debug(self)
Run the test without collecting errors in a TestResult
defaultTestResult(self)
doCleanups(self)
Execute all cleanup functions. Normally called for you after
tearDown.
fail(self, msg=None)
Fail immediately, with the given message.
failIf = deprecated_func(*args, **kwargs)
failIfAlmostEqual = deprecated_func(*args, **kwargs)
failIfEqual = deprecated_func(*args, **kwargs)
failUnless = deprecated_func(*args, **kwargs)
failUnlessAlmostEqual = deprecated_func(*args, **kwargs)
failUnlessEqual = deprecated_func(*args, **kwargs)
failUnlessRaises = deprecated_func(*args, **kwargs)
id(self)
run(self, result=None)
shortDescription(self)
Returns a one-line description of the test, or None if no
description has been provided.
 
The default implementation of this method returns the first line of
the specified test method's docstring.
skipTest(self, reason)
Skip this test.
tearDown(self)
Hook method for deconstructing the test fixture after testing it.

Class methods inherited from unittest.case.TestCase:
setUpClass(cls) from __builtin__.type
Hook method for setting up class fixture before running tests in the class.
tearDownClass(cls) from __builtin__.type
Hook method for deconstructing the class fixture after running all tests in the class.

Data descriptors inherited from unittest.case.TestCase:
__dict__
dictionary for instance variables (if defined)
__weakref__
list of weak references to the object (if defined)

Data and other attributes inherited from unittest.case.TestCase:
failureException = <type 'exceptions.AssertionError'>
Assertion failed.
longMessage = False
maxDiff = 640

 
class test_sequence(unittest.case.TestCase)
    
Method resolution order:
test_sequence
unittest.case.TestCase
__builtin__.object

Methods defined here:
testEquality(self)
testNonEquality(self)

Methods inherited from unittest.case.TestCase:
__call__(self, *args, **kwds)
__eq__(self, other)
__hash__(self)
__init__(self, methodName='runTest')
Create an instance of the class that will use the named test
method when executed. Raises a ValueError if the instance does
not have a method with the specified name.
__ne__(self, other)
__repr__(self)
__str__(self)
addCleanup(self, function, *args, **kwargs)
Add a function, with arguments, to be called when the test is
completed. Functions added are called on a LIFO basis and are
called after tearDown on test failure or success.
 
Cleanup items are called even if setUp fails (unlike tearDown).
addTypeEqualityFunc(self, typeobj, function)
Add a type specific assertEqual style function to compare a type.
 
This method is for use by TestCase subclasses that need to register
their own type equality functions to provide nicer error messages.
 
Args:
    typeobj: The data type to call this function on when both values
            are of the same type in assertEqual().
    function: The callable taking two arguments and an optional
            msg= argument that raises self.failureException with a
            useful error message when the two arguments are not equal.
assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertAlmostEquals = assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertDictContainsSubset(self, expected, actual, msg=None)
Checks whether actual is a superset of expected.
assertDictEqual(self, d1, d2, msg=None)
assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertEquals = assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertFalse(self, expr, msg=None)
Check that the expression is false.
assertGreater(self, a, b, msg=None)
Just like assertTrue(a > b), but with a nicer default message.
assertGreaterEqual(self, a, b, msg=None)
Just like assertTrue(a >= b), but with a nicer default message.
assertIn(self, member, container, msg=None)
Just like assertTrue(a in b), but with a nicer default message.
assertIs(self, expr1, expr2, msg=None)
Just like assertTrue(a is b), but with a nicer default message.
assertIsInstance(self, obj, cls, msg=None)
Same as assertTrue(isinstance(obj, cls)), with a nicer
default message.
assertIsNone(self, obj, msg=None)
Same as assertTrue(obj is None), with a nicer default message.
assertIsNot(self, expr1, expr2, msg=None)
Just like assertTrue(a is not b), but with a nicer default message.
assertIsNotNone(self, obj, msg=None)
Included for symmetry with assertIsNone.
assertItemsEqual(self, expected_seq, actual_seq, msg=None)
An unordered sequence specific comparison. It asserts that
actual_seq and expected_seq have the same element counts.
Equivalent to::
 
    assertEqual(Counter(iter(actual_seq)),
                     Counter(iter(expected_seq)))
 
Asserts that each element has the same count in both sequences.
Example:
    - [0, 1, 1] and [1, 0, 1] compare equal.
    - [0, 0, 1] and [0, 1] compare unequal.
assertLess(self, a, b, msg=None)
Just like assertTrue(a < b), but with a nicer default message.
assertLessEqual(self, a, b, msg=None)
Just like assertTrue(a <= b), but with a nicer default message.
assertListEqual(self, list1, list2, msg=None)
A list-specific equality assertion.
 
Args:
    list1: The first list to compare.
    list2: The second list to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assertMultiLineEqual(self, first, second, msg=None)
Assert that two multi-line strings are equal.
assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotAlmostEquals = assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotEquals = assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotIn(self, member, container, msg=None)
Just like assertTrue(a not in b), but with a nicer default message.
assertNotIsInstance(self, obj, cls, msg=None)
Included for symmetry with assertIsInstance.
assertNotRegexpMatches(self, text, unexpected_regexp, msg=None)
Fail the test if the text matches the regular expression.
assertRaises(self, excClass, callableObj=None, *args, **kwargs)
Fail unless an exception of class excClass is thrown
by callableObj when invoked with arguments args and keyword
arguments kwargs. If a different type of exception is
thrown, it will not be caught, and the test case will be
deemed to have suffered an error, exactly as for an
unexpected exception.
 
If called with callableObj omitted or None, will return a
context object used like this::
 
     with assertRaises(SomeException):
         do_something()
 
The context manager keeps a reference to the exception as
the 'exception' attribute. This allows you to inspect the
exception after the assertion::
 
    with assertRaises(SomeException) as cm:
        do_something()
    the_exception = cm.exception
    assertEqual(the_exception.error_code, 3)
assertRaisesRegexp(self, expected_exception, expected_regexp, callable_obj=None, *args, **kwargs)
Asserts that the message in a raised exception matches a regexp.
 
Args:
    expected_exception: Exception class expected to be raised.
    expected_regexp: Regexp (re pattern object or string) expected
            to be found in error message.
    callable_obj: Function to be called.
    args: Extra args.
    kwargs: Extra kwargs.
assertRegexpMatches(self, text, expected_regexp, msg=None)
Fail the test unless the text matches the regular expression.
assertSequenceEqual(self, seq1, seq2, msg=None, seq_type=None)
An equality assertion for ordered sequences (like lists and tuples).
 
For the purposes of this function, a valid ordered sequence type is one
which can be indexed, has a length, and has an equality operator.
 
Args:
    seq1: The first sequence to compare.
    seq2: The second sequence to compare.
    seq_type: The expected datatype of the sequences, or None if no
            datatype should be enforced.
    msg: Optional message to use on failure instead of a list of
            differences.
assertSetEqual(self, set1, set2, msg=None)
A set-specific equality assertion.
 
Args:
    set1: The first set to compare.
    set2: The second set to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
 
assertSetEqual uses ducktyping to support different types of sets, and
is optimized for sets specifically (parameters must support a
difference method).
assertTrue(self, expr, msg=None)
Check that the expression is true.
assertTupleEqual(self, tuple1, tuple2, msg=None)
A tuple-specific equality assertion.
 
Args:
    tuple1: The first tuple to compare.
    tuple2: The second tuple to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assert_ = assertTrue(self, expr, msg=None)
Check that the expression is true.
countTestCases(self)
debug(self)
Run the test without collecting errors in a TestResult
defaultTestResult(self)
doCleanups(self)
Execute all cleanup functions. Normally called for you after
tearDown.
fail(self, msg=None)
Fail immediately, with the given message.
failIf = deprecated_func(*args, **kwargs)
failIfAlmostEqual = deprecated_func(*args, **kwargs)
failIfEqual = deprecated_func(*args, **kwargs)
failUnless = deprecated_func(*args, **kwargs)
failUnlessAlmostEqual = deprecated_func(*args, **kwargs)
failUnlessEqual = deprecated_func(*args, **kwargs)
failUnlessRaises = deprecated_func(*args, **kwargs)
id(self)
run(self, result=None)
setUp(self)
Hook method for setting up the test fixture before exercising it.
shortDescription(self)
Returns a one-line description of the test, or None if no
description has been provided.
 
The default implementation of this method returns the first line of
the specified test method's docstring.
skipTest(self, reason)
Skip this test.
tearDown(self)
Hook method for deconstructing the test fixture after testing it.

Class methods inherited from unittest.case.TestCase:
setUpClass(cls) from __builtin__.type
Hook method for setting up class fixture before running tests in the class.
tearDownClass(cls) from __builtin__.type
Hook method for deconstructing the class fixture after running all tests in the class.

Data descriptors inherited from unittest.case.TestCase:
__dict__
dictionary for instance variables (if defined)
__weakref__
list of weak references to the object (if defined)

Data and other attributes inherited from unittest.case.TestCase:
failureException = <type 'exceptions.AssertionError'>
Assertion failed.
longMessage = False
maxDiff = 640

 
class test_sequence_parse(unittest.case.TestCase)
    
Method resolution order:
test_sequence_parse
unittest.case.TestCase
__builtin__.object

Methods defined here:
testFasta(self)
testPir(self)
testSequence(self)
testTolerantPir(self)
test_dbfetch_parse(self)
test_filename_selection(self)
test_known_formats(self)
test_ls_parse(self)
test_tf_parse(self)

Methods inherited from unittest.case.TestCase:
__call__(self, *args, **kwds)
__eq__(self, other)
__hash__(self)
__init__(self, methodName='runTest')
Create an instance of the class that will use the named test
method when executed. Raises a ValueError if the instance does
not have a method with the specified name.
__ne__(self, other)
__repr__(self)
__str__(self)
addCleanup(self, function, *args, **kwargs)
Add a function, with arguments, to be called when the test is
completed. Functions added are called on a LIFO basis and are
called after tearDown on test failure or success.
 
Cleanup items are called even if setUp fails (unlike tearDown).
addTypeEqualityFunc(self, typeobj, function)
Add a type specific assertEqual style function to compare a type.
 
This method is for use by TestCase subclasses that need to register
their own type equality functions to provide nicer error messages.
 
Args:
    typeobj: The data type to call this function on when both values
            are of the same type in assertEqual().
    function: The callable taking two arguments and an optional
            msg= argument that raises self.failureException with a
            useful error message when the two arguments are not equal.
assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertAlmostEquals = assertAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are unequal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is more than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
If the two objects compare equal then they will automatically
compare almost equal.
assertDictContainsSubset(self, expected, actual, msg=None)
Checks whether actual is a superset of expected.
assertDictEqual(self, d1, d2, msg=None)
assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertEquals = assertEqual(self, first, second, msg=None)
Fail if the two objects are unequal as determined by the '=='
operator.
assertFalse(self, expr, msg=None)
Check that the expression is false.
assertGreater(self, a, b, msg=None)
Just like assertTrue(a > b), but with a nicer default message.
assertGreaterEqual(self, a, b, msg=None)
Just like assertTrue(a >= b), but with a nicer default message.
assertIn(self, member, container, msg=None)
Just like assertTrue(a in b), but with a nicer default message.
assertIs(self, expr1, expr2, msg=None)
Just like assertTrue(a is b), but with a nicer default message.
assertIsInstance(self, obj, cls, msg=None)
Same as assertTrue(isinstance(obj, cls)), with a nicer
default message.
assertIsNone(self, obj, msg=None)
Same as assertTrue(obj is None), with a nicer default message.
assertIsNot(self, expr1, expr2, msg=None)
Just like assertTrue(a is not b), but with a nicer default message.
assertIsNotNone(self, obj, msg=None)
Included for symmetry with assertIsNone.
assertItemsEqual(self, expected_seq, actual_seq, msg=None)
An unordered sequence specific comparison. It asserts that
actual_seq and expected_seq have the same element counts.
Equivalent to::
 
    assertEqual(Counter(iter(actual_seq)),
                     Counter(iter(expected_seq)))
 
Asserts that each element has the same count in both sequences.
Example:
    - [0, 1, 1] and [1, 0, 1] compare equal.
    - [0, 0, 1] and [0, 1] compare unequal.
assertLess(self, a, b, msg=None)
Just like assertTrue(a < b), but with a nicer default message.
assertLessEqual(self, a, b, msg=None)
Just like assertTrue(a <= b), but with a nicer default message.
assertListEqual(self, list1, list2, msg=None)
A list-specific equality assertion.
 
Args:
    list1: The first list to compare.
    list2: The second list to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assertMultiLineEqual(self, first, second, msg=None)
Assert that two multi-line strings are equal.
assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotAlmostEquals = assertNotAlmostEqual(self, first, second, places=None, msg=None, delta=None)
Fail if the two objects are equal as determined by their
difference rounded to the given number of decimal places
(default 7) and comparing to zero, or by comparing that the
between the two objects is less than the given delta.
 
Note that decimal places (from zero) are usually not the same
as significant digits (measured from the most signficant digit).
 
Objects that are equal automatically fail.
assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotEquals = assertNotEqual(self, first, second, msg=None)
Fail if the two objects are equal as determined by the '=='
operator.
assertNotIn(self, member, container, msg=None)
Just like assertTrue(a not in b), but with a nicer default message.
assertNotIsInstance(self, obj, cls, msg=None)
Included for symmetry with assertIsInstance.
assertNotRegexpMatches(self, text, unexpected_regexp, msg=None)
Fail the test if the text matches the regular expression.
assertRaises(self, excClass, callableObj=None, *args, **kwargs)
Fail unless an exception of class excClass is thrown
by callableObj when invoked with arguments args and keyword
arguments kwargs. If a different type of exception is
thrown, it will not be caught, and the test case will be
deemed to have suffered an error, exactly as for an
unexpected exception.
 
If called with callableObj omitted or None, will return a
context object used like this::
 
     with assertRaises(SomeException):
         do_something()
 
The context manager keeps a reference to the exception as
the 'exception' attribute. This allows you to inspect the
exception after the assertion::
 
    with assertRaises(SomeException) as cm:
        do_something()
    the_exception = cm.exception
    assertEqual(the_exception.error_code, 3)
assertRaisesRegexp(self, expected_exception, expected_regexp, callable_obj=None, *args, **kwargs)
Asserts that the message in a raised exception matches a regexp.
 
Args:
    expected_exception: Exception class expected to be raised.
    expected_regexp: Regexp (re pattern object or string) expected
            to be found in error message.
    callable_obj: Function to be called.
    args: Extra args.
    kwargs: Extra kwargs.
assertRegexpMatches(self, text, expected_regexp, msg=None)
Fail the test unless the text matches the regular expression.
assertSequenceEqual(self, seq1, seq2, msg=None, seq_type=None)
An equality assertion for ordered sequences (like lists and tuples).
 
For the purposes of this function, a valid ordered sequence type is one
which can be indexed, has a length, and has an equality operator.
 
Args:
    seq1: The first sequence to compare.
    seq2: The second sequence to compare.
    seq_type: The expected datatype of the sequences, or None if no
            datatype should be enforced.
    msg: Optional message to use on failure instead of a list of
            differences.
assertSetEqual(self, set1, set2, msg=None)
A set-specific equality assertion.
 
Args:
    set1: The first set to compare.
    set2: The second set to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
 
assertSetEqual uses ducktyping to support different types of sets, and
is optimized for sets specifically (parameters must support a
difference method).
assertTrue(self, expr, msg=None)
Check that the expression is true.
assertTupleEqual(self, tuple1, tuple2, msg=None)
A tuple-specific equality assertion.
 
Args:
    tuple1: The first tuple to compare.
    tuple2: The second tuple to compare.
    msg: Optional message to use on failure instead of a list of
            differences.
assert_ = assertTrue(self, expr, msg=None)
Check that the expression is true.
countTestCases(self)
debug(self)
Run the test without collecting errors in a TestResult
defaultTestResult(self)
doCleanups(self)
Execute all cleanup functions. Normally called for you after
tearDown.
fail(self, msg=None)
Fail immediately, with the given message.
failIf = deprecated_func(*args, **kwargs)
failIfAlmostEqual = deprecated_func(*args, **kwargs)
failIfEqual = deprecated_func(*args, **kwargs)
failUnless = deprecated_func(*args, **kwargs)
failUnlessAlmostEqual = deprecated_func(*args, **kwargs)
failUnlessEqual = deprecated_func(*args, **kwargs)
failUnlessRaises = deprecated_func(*args, **kwargs)
id(self)
run(self, result=None)
setUp(self)
Hook method for setting up the test fixture before exercising it.
shortDescription(self)
Returns a one-line description of the test, or None if no
description has been provided.
 
The default implementation of this method returns the first line of
the specified test method's docstring.
skipTest(self, reason)
Skip this test.
tearDown(self)
Hook method for deconstructing the test fixture after testing it.

Class methods inherited from unittest.case.TestCase:
setUpClass(cls) from __builtin__.type
Hook method for setting up class fixture before running tests in the class.
tearDownClass(cls) from __builtin__.type
Hook method for deconstructing the class fixture after running all tests in the class.

Data descriptors inherited from unittest.case.TestCase:
__dict__
dictionary for instance variables (if defined)
__weakref__
list of weak references to the object (if defined)

Data and other attributes inherited from unittest.case.TestCase:
failureException = <type 'exceptions.AssertionError'>
Assertion failed.
longMessage = False
maxDiff = 640

 
Functions
       
exercise_merge_sequences()

 
Data
        ali_1ghl = 'GKVYGRCELAAAMKRMGLDNYRGYSLGNWVCAAKFESNFNTGATNRNT-DGSTDYGILQINSRWWCNDGRTPGSK'
ali_1hfy = '-EQLTKCEVFQKLK--DLKDYGGVSLPEWVCTAFHTSGYDTQAIVQNN--DSTEYGLFQINNKIWCKDDQNPHSR'
ali_1hml = '-KQFTKCELSQLLK--DIDGYGGIALPELICTMFHTSGYDTQAIVENN--ESTEYGLFQISNKLWCKSSQVPQSR'
ali_1lz3 = '-KVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKFESNFDTHATNRNT-DGSTDYGILQINSRWWCNDGRTPGSK'
ali_ali1 = '\n>2QZU:A\nQPTPNLVFIXADQYRGDAIGCIGKEPVKTPHLDKLASEG...GNGEELYDXKKDPGERK\nNLAKDPKYSKILAEHRALLDDYITRSKDDY\n'
ali_empt = '---------------------------------------------------------------------------'
alltests = <unittest.suite.TestSuite tests=[<unittest.suite..._hhalign_parser testMethod=test_process_hits>]>]>
clustal1 = 'CLUSTAL 2.0.10 multiple sequence alignment\n\n\nHor... 153\n .** . .:.:::* *. . . :::**:\n'
clustal2 = 'CLUSTAL X (1.81) multiple sequence alignment\n\n1v...LTETWLKEKLAFFR\n1ahq IQ-VEVQATD-AAEISEDAVSERAKK--\n'
dbfetch = '\n>PDB:1GAG_A\nVFPSSVFVPDEWEVSREKITLLRELGQGSFGMVYE...KDDLHPSFPEVSFF\nHSEENK\n\n>PDB:1GAG_B\nPATGDFMNMSPVG\n'
description_tmplt = 'Chain %s, Solution Structure Of The Ig-Like Domain'
division = _Feature((2, 2, 0, 'alpha', 2), (3, 0, 0, 'alpha', 0), 8192)
fasta = '\nError\n>FOSB_MOUSE Protein fosB. 338 bp\n MFQ...SY\n TSSFVLTCPEVSAFAGAQRTSGSEQPSDPLNSPSLLAL\n\n\n'
fasta_ali1 = '\n>2QZU:A Putative sulfatase from B. fragilis\nQPT...GNGEELYDXKKDPGERK\nNLAKDPKYSKILAEHRALLDDYITRSKDDY\n'
fasta_sequence = 'MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLG...GDPFPVVSPSYTSSFVLTCPEVSAFAGAQRTSGSEQPSDPLNSPSLLAL'
hhalignout = '\nQuery 1XVQ.pdb\nMatch_columns 155\nNo_of_...f 9997--3----013589999999742\n\n\nDone!\n'
hhsearchout = '\nQuery Thu_Sep_09_20:47:04_+0200_2010\nMa...cccCChhheEEEEEeHHHHHhhcCChHHHHHHHHHHHHHh\n\n\nDone!\n'
lineseparated = '\nAAKDVKFGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAR...AATEEYGNMIDMGILDPTKVTRSALQ\nYAASVAGLMITTECMVTDLP\n\n'
name1 = 'gi|159164330|pdb|2E6P|A'
name2 = 'Q8E5Q5_STRA3'
pir = '\nError\n>P1;CRAB_ANAPL\nALPHA CRYSTALLIN B CHAIN (...SLSLDG VLTVSAPRKQ\n SDVPERSIPI TREEKPAIAG AQRK*\n\n'
pir_ali1 = '\n>P1;Horse\n\nVLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGF...SEAIIHVLHSRHP\nGDFGADAQGAMNKALELFRKDIAAKYKELGYQG*\n'
pir_sequence = 'MDITIHNPLIRRPLFSWLAPSRIFDQIFGEHLQESELLPASPSLSPFL...DVDPLTITSSLSLDGVLTVSAPRKQSDVPERSIPITREEKPAIAGAQRK'
seq = '\nError\n>chain_A\n TPDCVTGKVE YTKYNDDDTF TVKVGDKEL...NLQSLL LSAQITGMTV TIKTNACHNG\n GGFSEVIFR*\n>chain_A'
seq_sequence = 'TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR'
sequence1 = 'VVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPSGPS'
sequence2 = 'LVKFYGRKFVLLFMDQKTFDKYESKLETSGYEKFFIFCMASPISPA'
suite_alignment = <unittest.suite.TestSuite tests=[<iotbx.tst_bioi...cs.test_alignment testMethod=test_multiplicity>]>
suite_alignment_parse = <unittest.suite.TestSuite tests=[<iotbx.tst_bioi..._alignment_parse testMethod=test_known_formats>]>
suite_clustal_alignment = <unittest.suite.TestSuite tests=[<iotbx.tst_bioi....test_clustal_alignment testMethod=test_format>]>
suite_fasta_alignment = <unittest.suite.TestSuite tests=[<iotbx.tst_bioi...cs.test_fasta_alignment testMethod=test_format>]>
suite_fasta_sequence = <unittest.suite.TestSuite tests=[<iotbx.tst_bioi...rmatics.test_fasta_sequence testMethod=testStr>]>
suite_hhalign_parser = <unittest.suite.TestSuite tests=[<iotbx.tst_bioi...st_hhalign_parser testMethod=test_process_hits>]>
suite_hhsearch_parser = <unittest.suite.TestSuite tests=[<iotbx.tst_bioi...t_hhsearch_parser testMethod=test_process_hits>]>
suite_midline = <unittest.suite.TestSuite tests=[<iotbx.tst_bioi...nformatics.test_midline testMethod=testMidline>]>
suite_pir_alignment = <unittest.suite.TestSuite tests=[<iotbx.tst_bioi...tics.test_pir_alignment testMethod=test_format>]>
suite_pir_sequence = <unittest.suite.TestSuite tests=[<iotbx.tst_bioi...formatics.test_pir_sequence testMethod=testStr>]>
suite_sequence = <unittest.suite.TestSuite tests=[<iotbx.tst_bioi...atics.test_sequence testMethod=testNonEquality>]>
suite_sequence_parse = <unittest.suite.TestSuite tests=[<iotbx.tst_bioi...s.test_sequence_parse testMethod=test_tf_parse>]>
tf = '\n> anb.pdb\nAAKDVKFGVNVLADAVKVTLGPKGRNVVLDKSFGAPT...AATEEYGNMIDMGILDP\nTKVTRSALQYAASVAGLMITTECMVTDLP\n\n'
tolerant_pir = '\nError\n>P1;CRAB_ANAPL\nALPHA CRYSTALLIN B CHAIN (...TSSLSLDG VLTVSAPRKQ\n SDVPERSIPI TREEKPAIAG AQRK\n'